McDonnell Genome Institute

Washington University

CircRNA

chr6|73765929|73818535|+|CD109|ENST00000287097.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9259

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

LNLYLDSVK

Amino Acids from 5' Exons

VKVTRADGNQLTLEERRNNVVITVTQRNYTEYWSGSNSGNQKMEAVQKINYTVPQSGTFKIEFPILEDSSELQLK,RLVLMATNLLKKEEIMSQHRETILSTGADLTVEIRKWKLFRKIILSPKVELLRLNSQSWRIPVSYS,EGNSCWQPTDSRKKKCSHNSDTEKLYVLERIQWKSENGSCSENKLYCPPKWNFDIPNPGGFQATVE

Amino Acids from 3' Exons

LFGPGEWHGSYGSPIKWLYGAFRSNFSERDSEESGISWKTQPLFRF,FSGPGRSGMALMEVNLLSGFMVPSEAISLSETVKKVEYDHGKLNLYLDS,FRARVGVAWLLWKLTYVALWCLQKQFLARQRKWNMIMENSTSII