McDonnell Genome Institute

Washington University

CircRNA

chr6|70486166|70526698|+|FAM135A|ENST00000194672.11

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9061

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

IFLTHVLLATAMHLALR

Amino Acids from 5' Exons

PRPTCSSYMSVFSEENSYEHRKTTI,QGQHAAPIASSQKKTATNTERQPS,KANMQLLYERLLRRKQLRTQKDNHL,PRPTCSSYMSVFSEENSYEHRKTTI,QGQHAAPIASSQKKTATNTERQPS,KANMQLLYERLLRRKQLRTQKDNHL

Amino Acids from 3' Exons

VNLISPRTIVKLHKWNTIWHPEGHQTIAMIIKQPHLWELEQLKSPVIKILSVERILSNDLGQSFDKRKYLWIIYYPTLSPNLMVNLNLKHLKRKLCKKQSVFLLENHLNYEVIYLPLLQKNIMLVEIQLSYQILVPHMPHLDFQIQVLKVNRVLLRHIQTLISLKLCKGKVLAIVKDYFLSFNLIIMNFHEIIVLRVQVLVKYSHLHPTLYPPMMNCHLMKILRNLLYLNAIMIAKLYIERLICQNVMILKSQVSLCNSRVLYFQGTWTMKLQYIPIQALKTLYNLFFQMKRLPVMKVVAAPNLTWILCVKASRVLINLITLQGQQLHIQNFVALLVSFQVPFLVIQMLVKIELKKIVMYISHRCIQKSLQLKVKLIWVQVILFQPVLISKGLWKIILVLKAVRIFLTHVLLATAMHLALRRKLLKKKLVIFSRNRIKRMRRKSRINKWFKMGTMKKQIIQLWMEQMLTIQAEMNWKKDLQNLKKTVTIEMVTCLLSVLLVVCPSRLHHESLLVMLNILPKVNLMPLQSSQAVLLTTSLLRFPGMKVHQNLKYK,TYLPGRNYTNGTQSGIQKVIRRLPSSNNPIFGSNNNKAQRSFQWREYNCQTRTLDRASTRGNTCGFTTQLVLRIWIIYRNNIKGSFARSKVSFYWRIINITKSTCPFYKRISCCSKWRYNVTRYCHICLIIFRFRCKTEFFCDTSKHFSLNCARARSLQKIISSAFDETLCKIFIRKSLYEYKCYKNTVIFDIHKLSTLRTVTKFEICCTMPSKQNCIKSRNDFAKMYKVKYHFATAECCIFRELGQNCSNTFLKFKHRPFTICFFRRDFQCEKLQLQTLGYYVRLPESILYRDSNYIKFKTDLFRHSLCHFRFHFYRCRNYEKKCIKSHTDVFRNPYSKNSSGYKSFFSQYYSKARACGKLFWFSKQYGYFHMCCLQQCTPSEGNFKRNSSAGTGRGGGRAGSTNGSKWVLRNRLFSFGWNNKCSLYKQRTNGRKTYKIKNKQLSERWYKHAYCLYFWLFVLPVCTTRVSLCIFFQKICHYKAAKQYFLQLHFFDFLVKFTKTSNTS,KLDISQDDSEITQMEHNLASRRSSDDCHDHQTTPSLGVRTIEIKPSNKDPFSGENITVKLGPWTELRQEEILVDNLLPNFESLESNGKSKSIEITFEKEALQEAKCLSIGESLTKLRSNLPAPSTKEYHVVVSGDTIKLPDISATYASSRFSDSGVESEPSSFATHPNTDLVFETVQGQGPCNSERLFPQLLMKPDYNVKFSLGNHCTESTSAISEIQSSLTSINSLPSDDELSPDENSKKSVVPECHLNDSKTVLNLGTTDLPKCDDTKKSSITLQQQSVVFSGNLDNETVAIHSLNSSIKDPLQFVFSDEETSSDVKSSCSSKPNLDTMCKGFQSPDKSNNSTGTAITLNSKLICLGTPCVISGSISSNTDVSEDRTMKKNSDVLNLTQMYSEIPTVESETHLGTSDPFSASTDIVKQGLVENYFGSQSSTDISDTCAVSYSNALSPQKETSEKEISNLQQEQDKEDEEEEQDQQMVQNGYYEETDYSALDGTINAHYTSRDELMEERLTKSEKINSDYLRDGINMPTVCTSGCLSFPSAPRESPCNVKYSSKSKFDAITKQPSSTSYNFTSSISWYESSPKPQIQ,VNLISPRTIVKLHKWNTIWHPEGHQTIAMIIKQPHLWELEQLKSPVIKILSVERILSNDLGQSFDKRKYLWIIYYPTLSPNLMVNLNLKHLKRKLCKKQSVFLLENHLNYEVIYLPLLQKNIMLVEIQLSYQILVPHMPHLDFQIQVLKVNRVLLRHIQTLISLKLCKGKVLAIVKDYFLSFNLIIMNFHEIIVLRVQVLVKYSHLHPTLYPPMMNCHLMKILRNLLYLNAIMIAKLYIERLICQNVMILKSQVSLCNSRVLYFQGTWTMKLQYIPIQALKTLYNLFFQMKRLPVMKVVAAPNLTWILCVKASRVLINLITLQGQQLHIQNFVALLVSFQVPFLVIQMLVKIELKKIVMYISHRCIQKSLQLKVKLIWVQVILFQPVLISKGLWKIILVLKAVRIFLTHVLLATAMHLALRRKLLKKKLVIFSRNRIKRMRRKSRINKWFKMGTMKKQIIQLWMEQMLTIQAEMNWKKDLQNLKKTVTIEMVTCLLSVLLVVCPSRLHHESLLVMLNILPKVNLMPLQSSQAVLLTTSLLRFPGMKVHQNLKYK,TYLPGRNYTNGTQSGIQKVIRRLPSSNNPIFGSNNNKAQRSFQWREYNCQTRTLDRASTRGNTCGFTTQLVLRIWIIYRNNIKGSFARSKVSFYWRIINITKSTCPFYKRISCCSKWRYNVTRYCHICLIIFRFRCKTEFFCDTSKHFSLNCARARSLQKIISSAFDETLCKIFIRKSLYEYKCYKNTVIFDIHKLSTLRTVTKFEICCTMPSKQNCIKSRNDFAKMYKVKYHFATAECCIFRELGQNCSNTFLKFKHRPFTICFFRRDFQCEKLQLQTLGYYVRLPESILYRDSNYIKFKTDLFRHSLCHFRFHFYRCRNYEKKCIKSHTDVFRNPYSKNSSGYKSFFSQYYSKARACGKLFWFSKQYGYFHMCCLQQCTPSEGNFKRNSSAGTGRGGGRAGSTNGSKWVLRNRLFSFGWNNKCSLYKQRTNGRKTYKIKNKQLSERWYKHAYCLYFWLFVLPVCTTRVSLCIFFQKICHYKAAKQYFLQLHFFDFLVKFTKTSNTS,KLDISQDDSEITQMEHNLASRRSSDDCHDHQTTPSLGVRTIEIKPSNKDPFSGENITVKLGPWTELRQEEILVDNLLPNFESLESNGKSKSIEITFEKEALQEAKCLSIGESLTKLRSNLPAPSTKEYHVVVSGDTIKLPDISATYASSRFSDSGVESEPSSFATHPNTDLVFETVQGQGPCNSERLFPQLLMKPDYNVKFSLGNHCTESTSAISEIQSSLTSINSLPSDDELSPDENSKKSVVPECHLNDSKTVLNLGTTDLPKCDDTKKSSITLQQQSVVFSGNLDNETVAIHSLNSSIKDPLQFVFSDEETSSDVKSSCSSKPNLDTMCKGFQSPDKSNNSTGTAITLNSKLICLGTPCVISGSISSNTDVSEDRTMKKNSDVLNLTQMYSEIPTVESETHLGTSDPFSASTDIVKQGLVENYFGSQSSTDISDTCAVSYSNALSPQKETSEKEISNLQQEQDKEDEEEEQDQQMVQNGYYEETDYSALDGTINAHYTSRDELMEERLTKSEKINSDYLRDGINMPTVCTSGCLSFPSAPRESPCNVKYSSKSKFDAITKQPSSTSYNFTSSISWYESSPKPQIQ