McDonnell Genome Institute

Washington University

CircRNA

chr6|6248311|6318682|-|F13A1|ENST00000264870.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9469

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

VGSAMDLVK

Amino Acids from 5' Exons

FEDGILDTCLYVMDRAQMDLSGRGNPIKVSRVGSAM,LKMASWTLACMWTEHKWTSLEEGIPSKSAVWGLQ,RWHPGHLPVCDGQSTNGPLWKRESHQSQPCGVCN

Amino Acids from 3' Exons

DLVKSKMSETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGVVPRGVNLQ,TLSQKCQKLPGPPLEAEEQFHPITLMQRKMTCPQWSFRAWCPGASTCK,PCKVKNVRNFQDRLWRQKSSSTQLCSGRPAHSGASGRGAPGRQPA