McDonnell Genome Institute

Washington University

CircRNA

chr6|6197222|6224860|-|F13A1|ENST00000264870.7

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9978

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

LTFLLDLEAGK

Amino Acids from 5' Exons

ELPLLESMDDKAPSCWIWRLASCGQHPPGKR,NYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSD,TTTAGMKHGQGLTFLLDLEAGKLWTAPPRKIAM

Amino Acids from 3' Exons

VNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDILLEYRSSENPVRYGQCWVFAGVFNT,MPKMTKVSSLDPGTISMPMASPHRPGLEALTFYWNTGALRIQSGMANAGFLLVSLTH,ECQRRRCPRWILGQYLCLWRPPIGLDWKRHSIGIPELESSPVWPMLGFCWCLH