McDonnell Genome Institute

Washington University

CircRNA

chr6|6151812|6167618|-|F13A1|ENST00000264870.7

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

TVTVEFTNPLK

Amino Acids from 5' Exons

VRGTQVVGSDMTVTVEFTNPLKETLRNVWVHLDGPGVTRPMKKMF,SVALRLVLTLQLSLPILKKPCEMSGYTWMVLEQDQRRCS,PWHSGSWFHDCDSVYQSFKRNPAKCLGTPGWSWSNKTNEEDVP

Amino Acids from 3' Exons

SRKRRCSKPASTWVSCWNKRPCTSLSQLASMRPGMFWPSKSPPCPSLRSSS,QERGGADPSRRVHGSAAGTSVPALLCHSSHQDQGCSGQAKVHRANHPDHHQ,KKEAVLIQAGEYMGQLLEQASLHFFVTARINETRDVLAKQKSTVLTIPEIIIK