McDonnell Genome Institute

Washington University

CircRNA

chr6|56851396|56900621|-|DST|ENST00000370754.9

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

3

Peptide

SGSASPAPGDTLPWNLPK

Amino Acids from 5' Exons

SSGNASYRCSMSSSADFSDEDDFSQKSGSASPAPGDTLPWNLPKHERSKRKIQGGSVLDPAERAVLRIA,VPGTRPIAALCLPLRIFPMRMISARNLAPHPQLRETPYPGICLNMRDRKERFKGAQCWTLPRGQCFGQ,FRERVLSLLYVFLCGFFRGFQPEIWLRIPSSGRHLTLEFATEIEKKDSRGLSAGPCREGSASDS

Amino Acids from 3' Exons

GFRASPRHLRRRVAAAAAARLEEVKPVVEVHHQSEQETSVRKRRIKKSSRVQPEFYHSVQGASIRRP,DSEQALGILEDELQRPQLPVWKKSPWWKFTIRVSKKLQGNEESRRAAESSQNFITLFKVLQSGG,IQSKPSASKTSCSGRSCPSGRSEARGGSSPSEARNFSEETKNQEEQPSPARILSLCSRCFNQEA