McDonnell Genome Institute

Washington University

CircRNA

chr6|56639258|56642101|-|DST|ENST00000244364.10

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9318

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

LTIEDSK

Amino Acids from 5' Exons

ELMRELDQKEENIKSVQEIAEQLLLENHPARLTIE,NENLIKRKKILNQFRRQSSYFKIIQPGLL,INERTSKGRKYISSGDSRAATSRKSSSPVNY

Amino Acids from 3' Exons

DSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQ,ILKDNQECSFRMKQKLLGIYLNVRTFYASMLMYRFLLMENTTRQINWYR,FKIRIRSAVSESRNCWVYTMEPFTPACNCTDSYWKILPGRSIGTE