McDonnell Genome Institute

Washington University

CircRNA

chr6|56634800|56640605|-|DST|ENST00000244364.10

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9629

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

LSVTTDK

Amino Acids from 5' Exons

EEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQIE,KRKKNFCSTKALQTWEKQKQFNSQGILTVHSKLLFRSKLSVTTDKL,RERRTSAVQKHYSKPNGKSKNNNSTEAKEFLSTQNFYSDQSYLLQTN

Amino Acids from 3' Exons

GCKTARNYGLKERMFFCVQQRTHTDNRTDKAHDIRNHSKFKLRICTDLTPSDLRADPEFNTFPNLFYDFWPVIRDDFPPDSICHSSLYTWFPIRISSKFQFRSRAKFIANFEVDADPKTPSKVFFAGSKFNRRRNQYEICSGSFELGDA,VAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLSSGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQ,LQNCVTKLWPGTNVLLCTAKDAYQQNRQSSYQESLKVTQDLHRPYTLVPQGPRVHLPPLLVLLACHQGLPALHLSLQLIHLVSHQDFQISVQESQIHCKLSCRSENPFSLLCWIKIQKKKSINLFRIFIGLMRC