McDonnell Genome Institute

Washington University

CircRNA

chr6|56603204|56614484|-|DST|ENST00000361203.7

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9811

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

QIMLAIDSEMK

Amino Acids from 5' Exons

TFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGHVEELSISHQSLKTAFSSLSNVSSERTKQIMLAIDSEM,HLNWDLQLLLFEKISWQKSFSLFPVTFPEAMLKNVLATRVRPPSLPSATCLQKERNRSCLRSTLK,IIGISSNCCYFKKRYEVGRRVFKVSSQLSQRPCRIEYPPEFEDRLLFPQQRVFRKNETDHACDRLN

Amino Acids from 3' Exons

KSLEEEKKEHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQK,SHWKKKRKNMLKKPKNCKNGYQISARHKMQRRLENLPSLSK,VTGRRKERTCKSQRIAKMGIKYQQDIERCREGWKTSLLAK