McDonnell Genome Institute

Washington University

CircRNA

chr6|56603204|56609344|-|DST|ENST00000361203.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9585

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

QIMLAIDSEMLDK

Amino Acids from 5' Exons

TFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGHVEELSISHQSLKTAFSSLSNVSSERTKQIMLAIDSEM,HLNWDLQLLLFEKISWQKSFSLFPVTFPEAMLKNVLATRVRPPSLPSATCLQKERNRSCLRSTLK,IIGISSNCCYFKKRYEVGRRVFKVSSQLSQRPCRIEYPPEFEDRLLFPQQRVFRKNETDHACDRLN

Amino Acids from 3' Exons

LDKVIAGTIDQTTGEVLSVFQAVLRGLIDYDTGIRLLETQLMISGLISPELRKCFDLKDAKSHGLIDEQILCQLKELSKAKEIISAASPTTIPVLDALAQSMITESMAIKVLEILLSTGSLVIPATGEQLTLQKAFQQNLVSSALFSKVLERQNMCKDLIDPCTSEKVSLIDMVQRSTLQENTGMWLLPVRPQEGGRITLKCGRNISILRAAHEGLIDRETMFRLLSAQLLSGGLINSNSGQRMTVEEAVREGVIDRDTASSILTYQVQTGGIIQSNPAKRLTVDEAVQCDLITSSSALLVLEAQRGYVGLIWPHSGEIFPTSSSLQQELITNELAYKILNGRQKIAALYIPESSQVIGLDAAKQLGIIDNNTASILKNITLPDKMPDLGDLEACKNARRWLSFCKFQPSTVHDYRQEEDVFDGEEPVTTQTSEETKKLFLSYLMINSYMDANTGQRLLLYDGDLDEAVGMLLEGCHAEFDGNTAIKECLDVLSSSGVFLNNASGREKDECTATPSSFNKCHCGEPEHEETPENRKCAIDEEFNEMRNTVINSEFSQSGKLASTISIDPKVNSSPSVCVPSLISYLTQTELADISMLRSDSENILTNYENQSRVETNERANECSHSKNIQNFPSDLIENPIMKSKMSKFCGVNETENEDNTNRDSPIFDYSPRLSALLSHDKLMHSQGSFNDTHTPESNGNKCEAPALSFSDKTMLSGQRIGEKFQDQFLGIAAINISLPGEQYGQKSLNMISSNPQVQYHNDKYISNTSGEDEKTHPGFQQMPEDKEDESEIEEYSCAVTPGGDTDNAIVSLTCATPLLDETISASDYETSLLNDQQNNTGTDTDSDDDFYDTPLFEDDDHDSLLLDGDDRDCLHPEDYDTLQEENDETASPADVFYDVSKENENSMVPQGAPVGSLSVKNKAHCLQDFLMDVEKDELDSGEKIHLNPVGSDKVNGQSLETGSERECTNILEGDESDSLTDYDIVGGKESFTASLKFDDSGSWRGRKEEYVTGQEFHSDTDHLDSMQSEESYGDYIYDSNDQDDDDDDGIDEEGGGIRDENGKPRCQNVAEDMDIQLCASILNENSDENENINTMILLDKMHSCSSLEKQQRVNVVQLASPSENNLVTEKSNLPEYTTEIAGKSKENLLNHEMVLKDVLPPIIKDTESEKTFGPASISHDNNNISSTSELGTDLANTKVKLIQGSELPELTDSVKGKDEYFKNMTPKVDSSLDHIICTEPDLIGKPAEESHLSLIASVTDKDPQGNGSDLIKGRDGKSDILIEDETSIQKMYLGEGEVLVEGLVEEENRHLKLLPGKNTRDSFKLINSQFPFPQITNNEELNQKGSLKKATVTLKDEPNNLQIIVSKSPVQFENLEEIFDTSVSKEISDDITSDITSWEGNTHFEESFTDGPEKELDLFTYLKHCAKNIKAKDVAKPNEDVPSHVLITAPPMKEHLQLGVNNTKEKSTSTQKDSPLNDMIQSNDLCSKESISGGGTEISQFTPESIEATLSILSRKHVEDVGKNDFLQSERCANGLGNDNSSNTLNTDYSFLEINNKKERIEQQLPKEQALSPRSQEKEVQIPELSQVFVEDVKDILKSRLKEGHMNPQEVEEPSACADTKILIQNLIKRITTSQLVNEASTVPSDSQMSDSSGVSPMTNSSELKPESRDDPFCIGNLKSELLLNILKQDQHSQKITGVFELMRELTHMEYDLEKRGITSKVLPLQLENIFYKLLADGYSEKIEHVGDFNQKACSTSEMMEEKPHILGDIKSKEGNYYSPNLETVKEIGLESSTVWASTLPRDEKLKDLCNDFPSHLECTSGSKEMASGDSSTEQ,WIKLQAPLIRQLEKSFQSFKQFEASLTMTQELGCLRHSFLVFHQNESALTLKMPKVMALLMNKFCANSKNVKLRRLFLLRHLPQFQYWMLLKAQNPWPSKFLRYCFLQALWLFQPQENSPYRRLSNRTWFPQHYFLKFWKGKICAKILLTPAPLRRFLIWYKEVLYRKTQGCGFYLDHKKEVEHNVEETAFEQLMKVSTVKPCLGCVHSFFLEVSIPTLAKELLKKLSEKGLTGTLLAVSSHIRFKLVESSSQTLPSVLTKQYSVILPAVLFWSWKLSEAMLDSFGPILVKYFPHHLPCSKNLQMNWPTKSMADKKLLFIFQKVLKSLVWMLLNSELTTTQHQFKIHCLIKCQIEIKLVKMPEDGSLFVNFNPPQFMITDKKRMFLMEKNLSLLRPQKKLKNYFYLIIAIWMQTQGKGFCCTMETWMRLLACYWKAVMQNLMETQPKNVSMSAHLVYFLIMLQVEKRMNVQLHQVVSINVTVENLNMKRLLKIESVLMKNLMKEILLSIVNFLSQENWQVQYQLILKLTVHPVCVFPVSYHIHRLNLQTLACLEVTLKTYLQTMKIKAEWKQMNVQMNVVILKTFKTFQVIKILLNQKVNSVVMKQRMKIIQTGIHLSLTIPPGVPCVMINCTVREVLMIHTPQRAMEISVKPQPYHSVTKPCCQVKEEKNFKTSFWELQLLTSVYQESSMDRNLIFLVILKYNITMINTFQILLVRMKKHIQVFSRCLKTRKMSLKKSIPVLLQGVILIMPLCLLLVLHHCLMKPSVLVTMKRHCMISRITQEQTLIVMMIFMILPCLKMMTMILCFLMVMIVIACTLRTTTHCKRKMMRRLLLLMFFMMSQKRMKIPWFPRGHQLVAVRTKHIVFRISLWMLRKMNILVKKYIILLAQIRMDSHWKLDQKGNAQISLKVMNLTHLIMILEEKRASLHHNLMTVAVGEEERKSMLDRNFTPILIIILCKVKKVMGIIYMTVMIRMTMMMMALMKKEEVEMRMESPGAKMWLKIWISSCVPLFMKTVMKMKILIQFFWIKCTVVALKNSKGMLYSHHLVKITLLKKATFQNIQLRLLEKAKKICTMRWYLRMYCRLSLKTLNLKKLLALQVFHMIIIISVQLLNVLIQTQRLSFKGQNCQNLILKVKMNILRIHQKLTHLLITSFVLSLIENLLRKAICHPLLTKILKEMEAISLKGEMAKVIFKMKHQFRKCTWVKEKCLKVKKKIGISNFCLVKIQGIVSSLIVSFHFHKSQTMKNLIRKEALKKQLLLKMNQIIYKLVKVLFSLRILKKFLTHQFPKRLVMTLLQTLHRGKGIHILRSHSLMDLRKSLICLLTNIVLKIKQKMPNQMKMSQAMFLPLPKNIYNELIIQKRSPLVPKKTHLLMTSKAMIFVVKKASQEEEQKFLSSHQKVLKPHFQYYLVNMKMLGKMIFCSRSGVQMDEMITPVTLILTIHSKLIIRKKELSNSYQKNKPCLQDPKKRRFRFLNCLRYLWRMRISKAGKKVITLKRLKNLQPVQTLKFFKILKGLPHHSWMRHLLCPATLKVTLLEFPPLTHQNSQKVEMILSVLEILSLSFSLIYSKINIAKKLQEYLNENLIWSMTRKEALRLKYFHCSLKIFSTNCLLMDIQRKNMLETLIKKHVLHLRWKKSHIFLVILKAKKETTILLIKLKKLDKALLCGHQHCQEMRSSRICVMISQAIWNVLQGLKRWLLEIAQPN,GSDCRHHSDNWRSPFSLSSSFKRPHLHRNVADTANDFWSNFTRIKKVLPRCQKSWPYTNSVPTQRTKSGDYFCCVTYHNSSTGCSSSKHDNRIHGHQSSDTAFYRLSGYSSHRRTVDPTEGFPTELGFLSIIFSSGKAKYVQRSYPLHLEGFFNRYGTKKYFTGKHRDVASTCETTRRRNNIKMWKKHKHFKSSSRSHRPNHVVVKCTASFWRSDQFQLWPKNDCRSCQRRGDQGHCQYPHISGSNWWNHPVKPCQAFNCRRSSTVFNNFQQCSSGPGSSARLCWTHLAPFWNISHIIFLAARIDYKIGLQNPEWQTKNSCSLYSRKFSSHWFGCCTARNYRQQHSINFKKYNTANARFRRFRSLKCQKMALFLISTLHSSLQTRRGCFWRRTCHYSDLRRNKIISILFNDKLYGCKHRAKAFAVRWRLGGCWHATGRLSCRIWKHSHKRMSRCLKLIWCISCFRRKGMYSYTKFQMSLWRTTRDSKKVCYRRINEKYCYQIFSVRKTGKYNINSSQFTQCVCSQSHIIFNTDTCRHHAKLKHTYKLKSKPSGNKTCKMSFKHSKLSKFNRKSYYEIKNEILWCENRERYKQGFTYLLFPQAKCLVKSIDAQSGKFYTHPREQWKVSPSLIIQQNHVVRSKNRRKISRPVSGNCSYHQFTRRAVWTEIFKYDFSSSTISQIHFKYFWGKNTSRFSADARQGRVNRRVFLCCDSRGYCHCVSYLCYTIANHQCLNVTAESAEHRNRHFLYSLVRPFFASWSLPAPGLRHTARGKDGFSCCFLCLKREKFHGSPGGTSWLKCEEQSTLSSGFPYGCERIRFWKNTFKSCWLRGEWTVTGNWIRKGMHKYPRILIDLYCRRKRELHCIIKIQWQLERKKGRVCNWTGISLRYSFRFYAKRKLWGLYIQSGRWHRRRRYKREWKAQVPKCGRYGYPVVCLYFKKQKKYYNDSSGNAQLLFRKTAKGKCCTASITKLSYKKQPSRIYNDCWKKQRKSVEPDGTGCIAAYHRHIKNFWPCKYFTYQFNFIRYSSKHKGVDSRVRIARIDFCERRIFEYDTKSLISSHHLYAFNRKTCGKPFVIDSLCNQRSSRKWKRSHRERWQKYSNRRNINSENVLGRRSACRRSSRRRKASQTFAWKYKGFQVNSVSISTNHKQRTSERKPKSNCNSRTKSTNNSKSCSVESRNFHISFQRDHYFRHYIVGREYTFGVIHWTERASVYLLKTLCKYKSKRCSQTKRCPKPCFNNCPSHERTFTIRSYKREVHYPKRLTSHDPKQSLRKHLRRRNRNFSVHTRKYSHTFNIISTCRRCWEKFSAVGAVCKWIRKLQHFKYLFILRNERKNATATKRTSLVSKIPRKGGSDSIVSGICGGCKGYLKKQVERRSYEPSRGRTFSLCRHNFNSKFNKDYHITVGKGIYCAQRLSNELFWSFPHDLIRTKARKRSFLYWKSVASPYIEARSTPKNYRSIIDERINSYGVPREKRHYVSTSTAAKYFLQTACWIFRENRTCWRLSKSMFYIDDGRKATYSWYKQRRKLLFSFRNCKRNWTRKLYCVGINIAKREAQGSVFPKPFGMYFRVRDGFWRLNRT