McDonnell Genome Institute

Washington University

CircRNA

chr6|56526360|56573887|-|DST|ENST00000244364.10

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9758

28

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

8

Peptide

SQQMTLLGDMR

Amino Acids from 5' Exons

ELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQ,NKRKLRTTKPYWTPLMKAVLCWNWYHGGQEKDLRKWLRTMSATDATPSLRRWRRSMQPFCDHS,TEKGSEQQSLTGLPSEQCFAGTGTMEGKRRTENGSGQALPISERHHHSEGGGDRCSHSAITA

Amino Acids from 3' Exons

MTLLGDMRICPSLLMNEMKNSRPPVHVCRMAWMKCWTGWEMWKVLKNKVKCLTLLLFRILSVKT,HCWEIGSVQVCTKKTPDNLDPFTECAGWLGNAGLDGKCGKFSERTRSSAFKLYCSSGYYQKH,DIVGRYEDLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKNI