McDonnell Genome Institute

Washington University

CircRNA

chr6|53516108|53520960|-|GCLC|ENST00000229416.10

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9729

29

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

37

Peptide

HPRFSHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEANMR

Amino Acids from 5' Exons

IRLSWVHTARGQTQPSGRRSFQVPLLSRSNKQAPSLQ,LGCPGFTLPEVKPNPVEGGASKSLFFPDEAINKHPRF,AVLGSHCPRSNPTQWKEELPSPSSFQMKQTSTLAS

Amino Acids from 3' Exons

PSYPLETRVWELHDRDTRTALRRNNVRVQYSGQHAKTPEGGYFYIRRKSGSLHNNFISQ,HPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEANMRKRRKEATSILEENQALCTITSFP,ILPFGDQSMGVTLKGHQDSPTEEQCPSSIQLRPTCENAGRRLLLYKKIRLFAQLHFP