McDonnell Genome Institute

Washington University

CircRNA

chr6|52469332|52490350|+|EFHC1|ENST00000371068.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9972

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

22

3

Peptide

EELPPYNGFGLVEDSAQNCFALIPK

Amino Acids from 5' Exons

ELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVLRYLAVL,SCLLITVLDWKILLRIVLLSFQKLQKKTLLKCWMITRCFVIWLY,VASLRFWTSGRFCSELFCSHSKSSKKRRYNAGEQGASLFGCT

Amino Acids from 3' Exons

QANKGSRRAGIGSINRHNSEATERSLMQRQHSGISNLQGSFRICGQRHVLNLIARPSGLLGG,KQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKE,SKLKRIQACRNWKHTQFRSNKITHAKTTFVRHFKFMTRKLQDMWTETCSLKSVNRLTSQWMTPWLR