McDonnell Genome Institute

Washington University

CircRNA

chr6|497366|549291|-|EXOC2|ENST00000230449.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.993

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

NGALQEQR

Amino Acids from 5' Exons

VFTISKELVPRVLSKVIEAVSEELSRLMQCVSSFSKNGALQ,CSPFPKNWSLGYYPRKQFLKSSVDCSVFHPSAKMELY,VHHFQRTGPSGTIQGDRSSFRAQSTDAVCFILQQKWSFT

Amino Acids from 3' Exons

EQRLLIVLSNCCYLERHTFLNIAEHFEKHNFQGIEKITQ,NSAFSVIAAINVTPSISQNILKSTTSREKKSH,TAPFDSPKLLLSRTSHLPKYRRTFKAQLPGNRKNHT