McDonnell Genome Institute

Washington University

CircRNA

chr6|47579384|47609304|+|CD2AP|ENST00000359314.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9927

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

LAGGGANLMVK

Amino Acids from 5' Exons

ETGEAGWWRGELNGKEGVFPDNFAVQINELDKDFP,RLEKLAGGGANLMVKKEYFQTILLSRMNLIKTF,DWRSWLVEGRTWRRSISRQFCCPDKTRLS

Amino Acids from 3' Exons

PSVYLSTPSSASKANTTAFLTPLEIKAKVETDDVKKNSLDELRAQIIELLCIVEALKKDH,HLCTFQHLPVLLKQIQLLSLHKSKLKWKQMMKKIPWMNLEPRLLNCCALKHKRIT,ICVPFNTFQCFSKYNCFPDSIRNQSSGNRCEKKFPGTSPDYIVVHCRSTEKGSR