McDonnell Genome Institute

Washington University

CircRNA

chr6|44419448|44426724|+|CDC5L|ENST00000371477.3

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9982

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

2

Peptide

KEAQNLMALTNVDTPLK

Amino Acids from 5' Exons

EAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPF,KPRTSWPSPMWTPHKVDLIPHCMRVTSQVLHSDKLYRLQTQFSLLHS,SPEPHGPHQCGHPIERWTYPIAELLRCNSTATSCTDSKHSSLYSIQ

Amino Acids from 3' Exons

VNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKK,MKLFDPMNRLQIYRKVKNSKKKSQCFIMTFYITLMNHLEIKKAKLGLVPIIQSTLPIWNIILMKSSPKKSK,KNYSKTLKCRTAFNRFTEKRTNQKRNDHNASLPSTSPLTIWKKRQNCRVWYQFRAHYLSGTSLKVLQRRAEK