McDonnell Genome Institute

Washington University

CircRNA

chr6|44251998|44253378|+|HSP90AB1|ENST00000353801.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9686

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

6

Peptide

MIKLGLGESKEQVANSAFVER

Amino Acids from 5' Exons

VRAKSRWPTQLLWSECGNGASRWYIPSPLTSTVCSSSRNLMGRAWSQLPRRVWSCLRMRRRRRRWKRARQSLRTSASSKKSIRRLR,EQRAGGQLSFCGASAETGLRGGIYDRAHRVLCAAAQGIWEEPGLSYQGGSGAAGGGEEEDGREQGKVEPLQAHERNLREGE,ESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEK

Amino Acids from 3' Exons

VTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGL,QSPIDLCLHLAALPAPTAGQPIWSGSKPRHFGTTPPWAIWPKSTWRSTLTTPLWRRCGRRLRPTRMIRQLRTWWCCCLKPPCYLLAFPLRIPRPTPTASIASSV,DNLQTCVFTLLHCDQHLRLDSQYGADHESPGTSGQLHHGLYDGQKAPGDQPPPHCGDAAAEGGRQEGSGPGGAAVNRPAIFWLFPGSPDPLQPHLSHDQARS