McDonnell Genome Institute

Washington University

CircRNA

chr6|43625755|43626410|-|GTPBP2|ENST00000307114.11

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9556

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

VPDNQQLK

Amino Acids from 5' Exons

GWGRHNRSSRARSGLRHAPEDHRGASTKGPQPT,VGADITVLREREVDYDSDMPRKITEVLVRKVPDNQQ,LGQTPFFESEKWIMIATCPGRSPRCYERSLTTN

Amino Acids from 3' Exons

LKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAE,SWIHPSTALSTWHKSGGSRRDVVRPSTRLGRTMGCWWGWLRRKCELRSRPCTGWQR,EAGESIPVPLAPGDTNEVAAPGGTWGRLPDWGRGQWAAGGAGGGNASFAQDPAPDGRE