McDonnell Genome Institute

Washington University

CircRNA

chr6|43282726|43284312|+|TTBK1|ENST00000259750.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9923

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

SPQAHCRPK

Amino Acids from 5' Exons

VFSVAPPFEVNGLPRAVPLSLPYQDFKRDLSDYRERARLLNRVRRVGFSHMLLTTPQVPLAPVQPQANGKEEEEEEEEDEEEEEEDEEEEEEEEEEEEEEEEEEEEEEEAAAAVALGEVLGPRSGSSSEGSERSTDRSQEGAPSTLLADDQKESRGRASMADGDLEPEEGSKTLVLVSPGDMKKSPVTAELAPDPDLGTLAALTPQHERPQPTGSQLDVSEPGTLSSVLKSEPKPPGPGAGLGAGTVTTGVGGVAVTSSPFTKVERTFVHIAEKTHLNVMSSGGQALRSEEFSAGGELGLELASDGGAVEEGARAPLENGLALSGLNGAEIEGSALSGAPRETPSEMATNSLPNGPALADGPAPVSPLEPSPEKVATISPRRHAMPGSRPRSRIPVLLSEEDTGSEPSGSLSAKERWSKRARPQQDLARLVMEKRQGRLLLRLASGASSSSSEEQRRASETLSGTGSEEDTPASEPAAALPRKSGRAAATRSRIPRPIGLRMPMPVAAQQPASRSHGAAPALDTAITS,CSPWRPHLRMASHELCLVCPTRTSKETSPITENGRGCSTGSGGWASRTCCSPPPRSHWLLFSLRLMGRRKRRRRRKMRKRKKRMRKKKRRKRKRRRKKRRRRKRRRRLQRQLPWGRCWGLVVAPAVRGVRGALTGARRVPRPRCWQTIRRSPGAGPPWPMGTWSLRRAPKRWCLSLLATRSRPSLPNWPPTPTWAPWLPSLLSMSGPSPRAASWTYLSQAPCPLSSSLSPSPRGLGQGWGPGQPQGSGAWQSPPHPSPKLRGPLCTLRRKPTSTSCLPVDKPCGLRSSALGASWVWSWPLMGALWRRGPERPWRTASPCQGMGLRRALPCLGPPGKPPQRWPQTHCPMARPLQTGQPRCPRWSQALRKWPPSPPDAMLCQALAPGAVSLSCSLRRTRARSPQAHCRPKSGGASGLGRSRTWRGWWRRGRAACCCGWPQGPRPPPVRSSAVPLRPSQARALRRTRPPLSRQRPCPGRAGGQPPPGAGFPAPLASACPCLLQPSSPPADPMARPQHWTQPSPA,VLRGAPIGEWPPTSCASESALPGLQKRPLRLPRTGAVAQQGPEGGLLAHAAHHPPGPTGSCSASGWEGGRGGGGGRGRGRRGGRRRGGRGRGGGRRGGGGRGGGGCSGSCLGGGAGASWLQQGEEEHPEPGGCPVHAAGRRSEGVQGPGLHGRWGPGAGGLQNAGACLSWRHEEVARHCRTGPRPRPGHPGCPHSSAAAPAHGQPAGRIARHPVLCPQVAQAPGAWGRAGGRDSDHRGRGRGSHLLTLHQSEDLCAHCGENPPQRHVFRWTSLAVGVQRWGRAGSGAGLWGRCGGGGPSAPGERPRPVRAEWGDRGLCPVWGPPGNPLRDGHKLTAQWPGPCRRASPGVPAGAKPESGHHLPQTPCYARLSPQEPYPCPALGGHGLGALRLTVGQRAVEQAGSAAAGPGAAGDGEEAGPPAVAAGLRGLVLLQGAAPCLDPLRHGLGGHARLAGSGLAQEEREGSRHQEPDSPPHWPPHAHACCSPAARQQIPWRGPSIGHSHHQQ

Amino Acids from 3' Exons

VFSVAPPFEVNGLPRAVPLSLPYQDFKRDLSDYRERARLLNRVRRVGFSHMLLTTPQVPLAPVQPQANGKEEEEEEEEDEEEEEEDEEEEEEEEEEEEEEEEEEEEEEEAAAAVALGEVLGPRSGSSSEGSERSTDRSQEGAPSTLLADDQKESRGRASMADGDLEPEEGSKTLVLVSPGDMKKSPVTAELAPDPDLGTLAALTPQHERPQPTGSQLDVSEPGTLSSVLKSEPKPPGPGAGLGAGTVTTGVGGVAVTSSPFTKVERTFVHIAEKTHLNVMSSGGQALRSEEFSAGGELGLELASDGGAVEEGARAPLENGLALSGLNGAEIEGSALSGAPRETPSEMATNSLPNGPALADGPAPVSPLEPSPEKVATISPRRHAMPGSRPRSRIPVLLSEEDTGSEPSGSLSAKERWSKRARPQQDLARLVMEKRQGRLLLRLASGASSSSSEEQRRASETLSGTGSEEDTPASEPAAALPRKSGRAAATRSRIPRPIGLRMPMPVAAQQPASRSHGAAPALDTAITS,CSPWRPHLRMASHELCLVCPTRTSKETSPITENGRGCSTGSGGWASRTCCSPPPRSHWLLFSLRLMGRRKRRRRRKMRKRKKRMRKKKRRKRKRRRKKRRRRKRRRRLQRQLPWGRCWGLVVAPAVRGVRGALTGARRVPRPRCWQTIRRSPGAGPPWPMGTWSLRRAPKRWCLSLLATRSRPSLPNWPPTPTWAPWLPSLLSMSGPSPRAASWTYLSQAPCPLSSSLSPSPRGLGQGWGPGQPQGSGAWQSPPHPSPKLRGPLCTLRRKPTSTSCLPVDKPCGLRSSALGASWVWSWPLMGALWRRGPERPWRTASPCQGMGLRRALPCLGPPGKPPQRWPQTHCPMARPLQTGQPRCPRWSQALRKWPPSPPDAMLCQALAPGAVSLSCSLRRTRARSPQAHCRPKSGGASGLGRSRTWRGWWRRGRAACCCGWPQGPRPPPVRSSAVPLRPSQARALRRTRPPLSRQRPCPGRAGGQPPPGAGFPAPLASACPCLLQPSSPPADPMARPQHWTQPSPA,VLRGAPIGEWPPTSCASESALPGLQKRPLRLPRTGAVAQQGPEGGLLAHAAHHPPGPTGSCSASGWEGGRGGGGGRGRGRRGGRRRGGRGRGGGRRGGGGRGGGGCSGSCLGGGAGASWLQQGEEEHPEPGGCPVHAAGRRSEGVQGPGLHGRWGPGAGGLQNAGACLSWRHEEVARHCRTGPRPRPGHPGCPHSSAAAPAHGQPAGRIARHPVLCPQVAQAPGAWGRAGGRDSDHRGRGRGSHLLTLHQSEDLCAHCGENPPQRHVFRWTSLAVGVQRWGRAGSGAGLWGRCGGGGPSAPGERPRPVRAEWGDRGLCPVWGPPGNPLRDGHKLTAQWPGPCRRASPGVPAGAKPESGHHLPQTPCYARLSPQEPYPCPALGGHGLGALRLTVGQRAVEQAGSAAAGPGAAGDGEEAGPPAVAAGLRGLVLLQGAAPCLDPLRHGLGGHARLAGSGLAQEEREGSRHQEPDSPPHWPPHAHACCSPAARQQIPWRGPSIGHSHHQQ