McDonnell Genome Institute

Washington University

CircRNA

chr6|42652490|42659855|+|UBR2|ENST00000372899.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9924

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

IQHSHLR

Amino Acids from 5' Exons

HSHLRCCLHSALCLQAWLTFCSQMSCCASWEQFCNGLWNIMDMPGQSPCCK,TPTSGVASILPSVCKPGHFAVRCHVVHHGNNSAMGCGTWICLVRVHAAK,LPPPVLPPFCPLFASLVNILQSDVMLCIMGTILQWAVEHNGYAWSESMLQR

Amino Acids from 3' Exons

PCGFRYDTYSTGPRTNSGSTKTIRYMYIVSRGARSSGKQGNGLGSICSEINCIIKKQKIYSRS,PVASDMTLTALGPAQTQVPEQRQFVTCILCQEEQEVKVESRAMVLAAFVQRSTVLSKNRSKFIQDP,LWLQIHLQHWAPHKLRFLNKDNSLHVYCVKRSKKLKWKAGQWSWQHLFRDQLYYQKTEVNLFKIQ