McDonnell Genome Institute

Washington University

CircRNA

chr6|42652022|42659855|+|UBR2|ENST00000372899.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9922

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

RSATEIEK

Amino Acids from 5' Exons

AEEAQRKLKRQNREDT,QKKRNGNKDKIEKIQ,RRSATEIEKTKRRY

Amino Acids from 3' Exons

PCGFRYDTYSTGPRTNSGSTKTIRYMYIVSRGARSSGKQGNGLGSICSEINCIIKKQKIYSRS,PVASDMTLTALGPAQTQVPEQRQFVTCILCQEEQEVKVESRAMVLAAFVQRSTVLSKNRSKFIQDP,LWLQIHLQHWAPHKLRFLNKDNSLHVYCVKRSKKLKWKAGQWSWQHLFRDQLYYQKTEVNLFKIQ