McDonnell Genome Institute

Washington University

CircRNA

chr6|42268153|42269848|-|TRERF1|ENST00000340840.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9166

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

MEPLTVLSASCCLR

Amino Acids from 5' Exons

VATSPHHSAVWSIPQPGRGCETPRPAHEWYRPTGTPGSSHVHRHVSRGVVLTLFSQLLRVSVLLGLFYLPFLWFCGWTFTTKADSMGDQQLYKTNHVAHGSENLFYQQPPLGVHSGLNHNYGNAVTGGGMDAPQASPISPHFPQDTRDGLGLPVGSKNLGQMDTSRQGGWGSHAGPGNHVQLRGNLANSNMMWGAPAQAEPTDGYQYTYSQASEIRTQKLTSGVLHKLDSFTQVFANQNLRIQVNNMAQVLHTQSAVMDGAPDSALRQLLSQKPMEPPAPAIPSRYQQVPQQPHPGFTGGLSKPALQVGQHPTQGHLYYDYQQPLAQVPVQGGQPLQAPQMLSQHMQQMQQHQYYPPQQQQQAGQQRISMQEIQTQPQQIRPSQPQPPPQQQQPQQLQLQQRQGSMQIPQYYQPQPMMQHLQEQQQQQMHLQPPSYHRDPHQYTPEQAHTVQLIPLGSMSQYYYQEPQQPYSHPLYQQSHLSQHQQREDSQLKTYSSDRQAQAMLSSHGDLGPPDTGMGDPASSDLTRVSSTLPHRPLLSPSGIHLNNMGPQHQQLSPSAMWPQ,CERRLLTTVLCGLYLSQGEDVKPPALHMSGTGQQEHLAPATFTDMSAVECHFSLSFSGFQSFWVCFIYLFYGFVAGRSQPRQTAWVTSNCTRPTMWPMVVRTFSTNSHHLASTAGTTTMGMQLQGAEWMPLRPRQSPPTSLKIHGMVWACLLAPKTLAKWIPRGREGGEVMQGLETMSSYVETWPTQTCGGHQPRLSPLMATNTPTPRPARSGPRSLPAVSYTSWTLSPRCLPTKTCEFRSTIWPRCCTLSQQWMEPLTVLSASCCLRSPWSPQHRLSLPATSRCPSSLTLVSLVGCPNQLFRSGSTLPKGTCIMTTSSLWLRCQCREDSHCRPHRCCHSTCNRCSSTSITHRSNSSKPGNSVSPCKKYRRSRNKFAHHSHSRRHSSSSRSSYSCSSGRVQCRYLSIISPNPCSTCKSSSSNRCTCSLLLITGTLTSIPQSRHTLSSFPWAPCPSTTTRSPSSPTATPSTSRATCPSTSSVRTVSRPTLVTDRPRPCAPMGTWGLLTQEWETQRAQIPGSAAPSPIAPSYPPVGSTSTTWGLSISSCLPVPCGP,VSDVSSPQCCVVYTSARERMNPPPCTVVQANRNTWLQPRSQTCQPWSSADTFLSASQGFSPFGFVLFTFFMVLWLDVHNQGRQHGPATVQDQPCGPWEPFLPTATTWRPQRAEPQLWECSYRGRNGCPSGLANLPPLPSRYTGWSGLACWLQKPWPNGYLEAGRVGKSCRAWKPCPATWKPGQLKHDVGGTSPGAHWLPIHLLPGQRDPDPEAYQRCLTQAGLFHPGVCQPKPANSGQQYGPGAAHSVSSDGWSPQCSPPAAVSEAHGAPSTGYPFPLPAGAPAASPWFHWWAVQTSSSGRAAPYPRAPVLLPAASGSGASAGRTATAGPTDAVTAHATDAAAPVLPTAATAASRATAYLHARNTDAAATNSPITATAAATAAAAAAATAAAAAGFNADTSVLSAPTHDAALARAAAATDAPAASFLSQGPSPVYPRAGTHCPADSPGLHVPVLLPGAPAALQPPPLPAEPPVPAPAAGQSAEDLLQTGPGHAELPWGPGASHRNGRPSELRSDPGQQHPPPSPPPIPQWDPPQQHGASASAAVSQCHVAP

Amino Acids from 3' Exons

VATSPHHSAVWSIPQPGRGCETPRPAHEWYRPTGTPGSSHVHRHVSRGVVLTLFSQLLRVSVLLGLFYLPFLWFCGWTFTTKADSMGDQQLYKTNHVAHGSENLFYQQPPLGVHSGLNHNYGNAVTGGGMDAPQASPISPHFPQDTRDGLGLPVGSKNLGQMDTSRQGGWGSHAGPGNHVQLRGNLANSNMMWGAPAQAEPTDGYQYTYSQASEIRTQKLTSGVLHKLDSFTQVFANQNLRIQVNNMAQVLHTQSAVMDGAPDSALRQLLSQKPMEPPAPAIPSRYQQVPQQPHPGFTGGLSKPALQVGQHPTQGHLYYDYQQPLAQVPVQGGQPLQAPQMLSQHMQQMQQHQYYPPQQQQQAGQQRISMQEIQTQPQQIRPSQPQPPPQQQQPQQLQLQQRQGSMQIPQYYQPQPMMQHLQEQQQQQMHLQPPSYHRDPHQYTPEQAHTVQLIPLGSMSQYYYQEPQQPYSHPLYQQSHLSQHQQREDSQLKTYSSDRQAQAMLSSHGDLGPPDTGMGDPASSDLTRVSSTLPHRPLLSPSGIHLNNMGPQHQQLSPSAMWPQ,CERRLLTTVLCGLYLSQGEDVKPPALHMSGTGQQEHLAPATFTDMSAVECHFSLSFSGFQSFWVCFIYLFYGFVAGRSQPRQTAWVTSNCTRPTMWPMVVRTFSTNSHHLASTAGTTTMGMQLQGAEWMPLRPRQSPPTSLKIHGMVWACLLAPKTLAKWIPRGREGGEVMQGLETMSSYVETWPTQTCGGHQPRLSPLMATNTPTPRPARSGPRSLPAVSYTSWTLSPRCLPTKTCEFRSTIWPRCCTLSQQWMEPLTVLSASCCLRSPWSPQHRLSLPATSRCPSSLTLVSLVGCPNQLFRSGSTLPKGTCIMTTSSLWLRCQCREDSHCRPHRCCHSTCNRCSSTSITHRSNSSKPGNSVSPCKKYRRSRNKFAHHSHSRRHSSSSRSSYSCSSGRVQCRYLSIISPNPCSTCKSSSSNRCTCSLLLITGTLTSIPQSRHTLSSFPWAPCPSTTTRSPSSPTATPSTSRATCPSTSSVRTVSRPTLVTDRPRPCAPMGTWGLLTQEWETQRAQIPGSAAPSPIAPSYPPVGSTSTTWGLSISSCLPVPCGP,VSDVSSPQCCVVYTSARERMNPPPCTVVQANRNTWLQPRSQTCQPWSSADTFLSASQGFSPFGFVLFTFFMVLWLDVHNQGRQHGPATVQDQPCGPWEPFLPTATTWRPQRAEPQLWECSYRGRNGCPSGLANLPPLPSRYTGWSGLACWLQKPWPNGYLEAGRVGKSCRAWKPCPATWKPGQLKHDVGGTSPGAHWLPIHLLPGQRDPDPEAYQRCLTQAGLFHPGVCQPKPANSGQQYGPGAAHSVSSDGWSPQCSPPAAVSEAHGAPSTGYPFPLPAGAPAASPWFHWWAVQTSSSGRAAPYPRAPVLLPAASGSGASAGRTATAGPTDAVTAHATDAAAPVLPTAATAASRATAYLHARNTDAAATNSPITATAAATAAAAAAATAAAAAGFNADTSVLSAPTHDAALARAAAATDAPAASFLSQGPSPVYPRAGTHCPADSPGLHVPVLLPGAPAALQPPPLPAEPPVPAPAAGQSAEDLLQTGPGHAELPWGPGASHRNGRPSELRSDPGQQHPPPSPPPIPQWDPPQQHGASASAAVSQCHVAP