McDonnell Genome Institute

Washington University

CircRNA

chr6|39613188|39639757|-|KIF6|ENST00000287152.11

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9991

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

EDIHYHR

Amino Acids from 5' Exons

ESDNTGGSSEHSPEKLDSPSGNHRGRSSEFAFFRRHQPNDCR,KVTILEDPDQNIHLKNLTLHQATTEEEALNLLFLGDTNRMIAE,KQYWRILIRTFTKTLSIRQPQRKKLICFFETPTELQ

Amino Acids from 3' Exons

CPGRLQWYHLCIWANRQREDIHYHRGCRALQQRHYPKDTVIHFTVTK,VLAGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYIFEQLQK,SWQVTMVPSLHMGKQAAGRHSLSQGVQSVTVTEALSQGHCHTFLNSYK