McDonnell Genome Institute

Washington University

CircRNA

chr6|394820|398935|+|IRF4|ENST00000380956.8

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9546

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

SQAWALFK

Amino Acids from 5' Exons

AWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKK,LGHCLKESSEKASTSRTLPPGRRACGALTRAMTLRNWLSGASWTSQTRTKCTGLFLREPKK,LGTVRKVPRRHRQAGPSHLEDAPAVRFEQEQLGTGAEPAGHLRPVQSVQDCSGSQK

Amino Acids from 3' Exons

VARQEPFMLVPHLSPRLPESPQSQAGLPKPWRSQ,LPGDRNLLCLCPTVPGSRSPHRAKHKVCRSLGVL,CQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFS