McDonnell Genome Institute

Washington University

CircRNA

chr6|38116571|38116739|+|ZFAND3|ENST00000287218.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9444

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

11

Peptide

CDSQSENEASPVK

Amino Acids from 5' Exons

IHSLRMRLHQNGHDYLRIRNGPRKPVDLNRRVDVGASSAKPNWSWCSRNWDRVAA,FTVEGFTSKTATTTEYGTVRGNQSITEESTSVLPVPNQTGAGAAGIGIVSL,SQSENEASPVKRPRLLENTERSEETSRSKQKSRRRCFQCQTKLELVQQELGSCRC

Amino Acids from 3' Exons

IHSLRMRLHQNGHDYLRIRNGPRKPVDLNRRVDVGASSAKPNWSWCSRNWDRVAA,FTVEGFTSKTATTTEYGTVRGNQSITEESTSVLPVPNQTGAGAAGIGIVSL,SQSENEASPVKRPRLLENTERSEETSRSKQKSRRRCFQCQTKLELVQQELGSCRC