McDonnell Genome Institute

Washington University

CircRNA

chr6|37013608|37025938|+|FGD2|ENST00000274963.12

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9849

37

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

LEMCCLRPR

Amino Acids from 5' Exons

DSPPHRRDPEAGPLPEDVQVCQELASGAAGHLDRQVSTLPGGSHSHP,TANPRIGDVIQKLAPFLKMYSEYVKNFERAAELLATWTDKSPLFQEVLTRIQ,QLTPASVTSRSWPPSRCTVSMSRTLSERLSCWPPGPTSLHSSRRFSLAS

Amino Acids from 3' Exons

VVCARCSDYRAELKYDDNRPNRVCLHCYAFLTGNVLPEAKEDKRRGILE,WCVPGAPTTGPNNTTTTGPTESASTATHSSLEMCCLRPRRTRGGASW,GVCQVLRLPGRTEIRRQQAQPSLPPLLRIPHWKCAAGQGGQEAGHPG