McDonnell Genome Institute

Washington University

CircRNA

chr6|36470051|36481759|+|KCTD20|ENST00000265344.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9826

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

FLSDQTDSSGLR

Amino Acids from 5' Exons

DFSLIKRTVQDSESKDECSPWQQQVIAAGGQLLSGYFSCSPRKRSKQPGFIWSSSYLSSRSQE,ISLSNGQFRTQNLRMNVHRGSDSDRLLRQEASCLVDDTLAVAQEKEANSLASSGPHNLTYPLGPRNE,FLSDQTDSSGLRIGMFTVAVTVTGYCGRRPAAWMILLPKKKKQTAWLHLVLIILLILVPGMK

Amino Acids from 3' Exons

VLYSMNCLMTVLISSLITTSKSSSCPSWWAVPRKENESATLLCRMRILWTGMKTTLHQWGRNIPK,CFTPTVRCSAVSLPRRAHLAHHGGLCQERRTRVPHCCADGGFCGLGRPPSTNGGGIFP,ALLHELSNDGAHKQFDHYLEELILPIMVGCAKKGERECHIVVLTDEDSVDWDEDHPPPMGEEYSQ