McDonnell Genome Institute

Washington University

CircRNA

chr6|36200296|36204814|+|BRPF3|ENST00000339717.11

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9969

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

ISPNAIVTR

Amino Acids from 5' Exons

ACPLSSQVPGSLVGSPGRMPRAGVPRPPTVSSAHPPGRPHMPRPSGLSRTLMDACIVSASMTHSKSLLKMSLPRISPNAIVTRKTVNSLSSLASPRNPHPRAKRRNPAPSMHLVLPSTSHSPASVWWTQASSQKHPRCLLPTTATLRSHLKTWMQRSMTWMRRTLPGWTWMKNGEMGTVWCLQIPLSCWTGLRKSHTWRVAAVGPNSHSSMKTLSAVCAWMMNVTIAMLFSSVTSATWLYTRSAMASHTSLRASGYAAAACSLPPGLWIASFAPIRVAPSNRPVMGTGPMWCVPSGSLKSALLTPCSWNLLRALTISRLPAGNPAISASRKGVQPSSAIRTATQHSMHVHSGLGSSRLSPCAKPASMAPSLQCARLPTVRPTRHQVRPLLGGRATPLEASVRLAMRKGRRVMERRKKRKRWRKKSRKLKAGVAPSRECPRKARVSRRSRRSQRKQAKTHPPLSPCLLSHRYPLT,PVPSVPRCHEEASSEVPAECRGPAFPVPLQSQVLTHPGDPDICPGPADCRGRHWTPASYQHLPTQNHYRANCPGYHRMQQGKQTASVPWQVQETLIQGQKEGILLQACIWYFLPPPTAQLPYGGLRHPARSTPAACCLLPLHEATRPGCRGRVHGGGPCLAGHGEKTASRWAQFGVCRYLAAGRPAERVILGESQQWGPTVTHRRRFLLCVPGMSQQCYSLLHLQPGCTPGVLWRPIHPGPVAMPLLPAVSLPACGLHPLPQGWRLQTDQWALGPCGVCHLDPSLLCHRVLGTYGHQYPACPLETNLLYLQAERARCSHPVPGELLHSIPCDMCTAGWALHEDAHARNQPQWHHLYSAQDCLLGPLATRCGHCEEGRLPKHQDWRGRAEGGWRGGRRGRGGGRRAGSSRRGEWLPQGSAQEKQDEFEAEDQEGARGSRPRHTLHSPHACCPTDTLLQ,LSPQFPGAMRKPRRKSRQNAEGRRSPSPYSLKCSPTRETLTYAQAQRIVEVDIDGRLHRISIYDPLKIITEDELTAQDITECNSNKENSEQPQFPGKSKKPSSKGKKKESCSKHASGTSFHLPQPSFRMVDSGIQPEAPPLPAAYYRYIEKPPEDLDAEVEYDMDEEDLAWLDMVNEKRRVDGHSLVSADTFELLVDRLEKESYLESRSSGAQQSLIDEDAFCCVCLDDECHNSNVILFCDICNLAVHQECYGVPYIPEGQWLCRCCLQSPSRPVDCILCPNKGGAFKQTSDGHWAHVVCAIWIPEVCFANTVFLEPIEGIDNIPPARWKLTCYICKQKGLGAAIQCHKVNCYTAFHVTCAQRAGLFMKIEPMRETSLNGTIFTVRKTAYCEAHSPPGAATARRKGDSPRSISETGDEEGLKEGDGEEEEEEEVEEEEQEAQGGVSGSLKGVPKKSKMSLKQKIKKEPEEAGQDTPSTLPMLAVPQIPSY

Amino Acids from 3' Exons

VEQDLWSLLSEEKPVYAAASQLLAVEAAGTEWCPSYPALALPSAVPKKRA,LNKICSGLSFQRKNQFMQRLHNYWLLKRQARNGVPLIRRLHSHLQSQRNAEQ,TRSVVVSPFRGKTSLCSGFTIIGCSGRHGMVSLLSGACTPICSPKETLS