McDonnell Genome Institute

Washington University

CircRNA

chr6|34858123|34859571|+|UHRF1BP1|ENST00000192788.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9974

30

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

LPPIHVMLHIVVVQTSR

Amino Acids from 5' Exons

VSFPLEKRERAELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHAFQMDSCLPQPNTLPPQRPKASWDLWSVHFTQISLDFEGTENFKGHTLNFVAPFPLSIWACLPLRWQQAQARKLLLASEGRLKPSASFGSPVQSEALAPDSMSHPRSKTEHDLKSLSGLTEVMEILKEGSSGMDNKGPLTELEDVADVHMLVHSPAHVRVRLDHYQYLALLRLKEVLQRLQEQLTKDTESMTGSPLQNQTACIGVLFPSAEVALLMHPAPGAVDADSAGSDSTSLVDSELSPSEDRELKSDASSDQGPASPEKVLEESSIENQDVSQERPHSNGELQDSGPLAQQLAGKGHEAVESLQAKKLSRTQASSSPAALKPPAGRETAVNGQGELIPLKNIEGELSSAIHMTKDATKEALHATMDLTKEAVSLTKDAFSLGRDRMTSTMHKMLSLPPA,AFHWKRESGQSCIVPRPLSSLRQALPPIHVMLHIVVVQTSRVSSGVLLLLSSFIPIMITFLRFQVALAFCTCFFCIMPFRWIPACLSLIPSLPRDLRLPGISGLSTLPRSPWTLREQKTSKAIPILPPSPCPFGPAYPSAGSKPRHGSFFWPQRGGNHQPVLEVLSSLRLLPLTLCPIRGQRLNMTKAYQDLQKSWKFKKAVVVWTTKGLQSWRMQMFICLYIPRPMSAGLTTTSTWLCFARRCCRGFRSSLRIQSQLGLPCRIRQLALEFSFPVLKWLCLCILHPVLSMLTLQAQIALASIQSYLLQRIGNSLMPHQTRAQQALRRSWRKVALKIRMYPRRGHIAMENCRTQVHLPSSWQGRAMRQSPYRPRNAEPKPPAHQLHSPQLAGRLLMDRVSSSPRTLRENCQVLFTPRMPPRRLYMPPWTSPRKLCPLRMPSVWAEIEPPPCTRCCPCPQP,ELSTGKERAGRVASSPGPCLLCVRHDCHQYTSCSTLLFRPPESLPGFCCCVLSFQLSLSGSRWLPSAHAFFASCLSDGFLPASAYPPSPETGFLGSLVCPLYPDLLGLGNRKLQRPYLEFCSPLPPVHLGLPTPPLAASPGTEASFGLRGEAETISQFWKSCPVGSCPLYVPSAVKDTLEKLIRTYRSHGNSERRQWYGQQRASDRAGGCSRCSYACTFPGPCPREAPLPVLGSASPEGGAAEASGAADGYRVNDWVSPAESDSLHWSSLSQCSGSAYASCTRCCRCLCRLRHPRRFRAISFRGSGTEVCLIRPGPSKPEGLGGKHKSGCIPGEATQWRTAGLRSTCPAAGREGPGSRVPTGQETEQNPSLQLTSCIEAPSWQGDCCEWTGAHPLEEHGRIVKCYSHDQGCHQGGSTCHHGPHQGSCVPDGCLQFGQRSNDLHHAQDVVPAPSQ

Amino Acids from 3' Exons

VSFPLEKRERAELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHAFQMDSCLPQPNTLPPQRPKASWDLWSVHFTQISLDFEGTENFKGHTLNFVAPFPLSIWACLPLRWQQAQARKLLLASEGRLKPSASFGSPVQSEALAPDSMSHPRSKTEHDLKSLSGLTEVMEILKEGSSGMDNKGPLTELEDVADVHMLVHSPAHVRVRLDHYQYLALLRLKEVLQRLQEQLTKDTESMTGSPLQNQTACIGVLFPSAEVALLMHPAPGAVDADSAGSDSTSLVDSELSPSEDRELKSDASSDQGPASPEKVLEESSIENQDVSQERPHSNGELQDSGPLAQQLAGKGHEAVESLQAKKLSRTQASSSPAALKPPAGRETAVNGQGELIPLKNIEGELSSAIHMTKDATKEALHATMDLTKEAVSLTKDAFSLGRDRMTSTMHKMLSLPPA,AFHWKRESGQSCIVPRPLSSLRQALPPIHVMLHIVVVQTSRVSSGVLLLLSSFIPIMITFLRFQVALAFCTCFFCIMPFRWIPACLSLIPSLPRDLRLPGISGLSTLPRSPWTLREQKTSKAIPILPPSPCPFGPAYPSAGSKPRHGSFFWPQRGGNHQPVLEVLSSLRLLPLTLCPIRGQRLNMTKAYQDLQKSWKFKKAVVVWTTKGLQSWRMQMFICLYIPRPMSAGLTTTSTWLCFARRCCRGFRSSLRIQSQLGLPCRIRQLALEFSFPVLKWLCLCILHPVLSMLTLQAQIALASIQSYLLQRIGNSLMPHQTRAQQALRRSWRKVALKIRMYPRRGHIAMENCRTQVHLPSSWQGRAMRQSPYRPRNAEPKPPAHQLHSPQLAGRLLMDRVSSSPRTLRENCQVLFTPRMPPRRLYMPPWTSPRKLCPLRMPSVWAEIEPPPCTRCCPCPQP,ELSTGKERAGRVASSPGPCLLCVRHDCHQYTSCSTLLFRPPESLPGFCCCVLSFQLSLSGSRWLPSAHAFFASCLSDGFLPASAYPPSPETGFLGSLVCPLYPDLLGLGNRKLQRPYLEFCSPLPPVHLGLPTPPLAASPGTEASFGLRGEAETISQFWKSCPVGSCPLYVPSAVKDTLEKLIRTYRSHGNSERRQWYGQQRASDRAGGCSRCSYACTFPGPCPREAPLPVLGSASPEGGAAEASGAADGYRVNDWVSPAESDSLHWSSLSQCSGSAYASCTRCCRCLCRLRHPRRFRAISFRGSGTEVCLIRPGPSKPEGLGGKHKSGCIPGEATQWRTAGLRSTCPAAGREGPGSRVPTGQETEQNPSLQLTSCIEAPSWQGDCCEWTGAHPLEEHGRIVKCYSHDQGCHQGGSTCHHGPHQGSCVPDGCLQFGQRSNDLHHAQDVVPAPSQ