McDonnell Genome Institute

Washington University

CircRNA

chr6|34132977|34133859|-|GRM4|ENST00000374181.8

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9992

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

TGLQDGTR

Amino Acids from 5' Exons

VGRRRGLELFSPCQDTPSEHSALSTVIHREQACRTGQGSEPSCNPGHCLLSVGLDCAGNCAWPEQGGGRGQHGLRGWLPSVPLLLKLPCPCPPRPWGQGPARARSGPAVHGSLGISEMPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGRGSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSLTFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFK,LVGGEDWSCFLLDAKIRQARSILPFPQSSTENRPAGRDKDQSLPATPATACCLWAWTVRATVLGPSDKEVGEGSSMGYAVGCPQSPCCSCPAHAHPGRGARGLPGLGVGLPFMGLGFPRCLGREAWAGGGPGCPFACSSAFTAPGCLPPWESPKATLTIPSAMGTSHWEACSRCMAGAQRASPVENLRRKRASTGWRPCCSPWIASTTTRTCCLTSRWAPAFWTPAPGTPMPSSSRPLCRRSSRRMAQRSAVAVAAHPSSPSLNVWWVSSVLQGARSPSWWPTSFASS,WEERIGAVFSLMPRYAKLGAFCPFHSHPPRTGLQDGTRIRAFLQPRPLPAVCGPGLCGQLCLARVTRRWERVAAWATRLAALSPPAAEAALPMPTQAVGPGACQGEWACRSWVSRDFRDAWEERLGLVVGPAAPLPAPQPLRPLDAFLPGKAQRPPSHEFHPHRWGHHTGRPVPGAWPGLRGQALWRTEGKGHPPAGGHAVRPGSHQQRPGPAAHHAGRPHSGHLLQGHPCPRAVADLCAGAHREGWHRGPLWQWRPTHHHQATCGGCHRCFRELGLHHGGQHPSPLQ

Amino Acids from 3' Exons

VGRRRGLELFSPCQDTPSEHSALSTVIHREQACRTGQGSEPSCNPGHCLLSVGLDCAGNCAWPEQGGGRGQHGLRGWLPSVPLLLKLPCPCPPRPWGQGPARARSGPAVHGSLGISEMPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGRGSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSLTFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFK,LVGGEDWSCFLLDAKIRQARSILPFPQSSTENRPAGRDKDQSLPATPATACCLWAWTVRATVLGPSDKEVGEGSSMGYAVGCPQSPCCSCPAHAHPGRGARGLPGLGVGLPFMGLGFPRCLGREAWAGGGPGCPFACSSAFTAPGCLPPWESPKATLTIPSAMGTSHWEACSRCMAGAQRASPVENLRRKRASTGWRPCCSPWIASTTTRTCCLTSRWAPAFWTPAPGTPMPSSSRPLCRRSSRRMAQRSAVAVAAHPSSPSLNVWWVSSVLQGARSPSWWPTSFASS,WEERIGAVFSLMPRYAKLGAFCPFHSHPPRTGLQDGTRIRAFLQPRPLPAVCGPGLCGQLCLARVTRRWERVAAWATRLAALSPPAAEAALPMPTQAVGPGACQGEWACRSWVSRDFRDAWEERLGLVVGPAAPLPAPQPLRPLDAFLPGKAQRPPSHEFHPHRWGHHTGRPVPGAWPGLRGQALWRTEGKGHPPAGGHAVRPGSHQQRPGPAAHHAGRPHSGHLLQGHPCPRAVADLCAGAHREGWHRGPLWQWRPTHHHQATCGGCHRCFRELGLHHGGQHPSPLQ