McDonnell Genome Institute

Washington University

CircRNA

chr6|33403728|33404129|+|KIFC1|ENST00000428849.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9523

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

10

Peptide

GEGASGVPPMAGGK

Amino Acids from 5' Exons

HQVFLPWQEGRNPANVQPGTRVSYVTMQNNGAVRGLKRWTKRTSSFRTSSEMPSSRSRPWGQSAQHWRGIPRYRPRLSRANRSRTCVLVSWSWKSGARRRAWCKSFRKNRWNCRKNGGDCPNRRR,IRCSSHGRREETQQTSSLGLKGSVMPKCRTKTVPEDSNVGPREPAASGPAQRCPAAGQGPGDRAHNTGGAFSQGTGPGAGPTGAEELACLCPGAGRAAEHAGGLGARASEKTGGIAGRTEGTDVPTRGEG,SGVPPMAGGKKPSKRPAWDLKGQLCDLNAELKRCRERTQTLDQENQQLQDQLRDAQQQVKALGTERTTLEGHLAKVQAQAEQGQQELKNLRACVLELEERLSTQEGLVQELQKKQVELQEERRGLMSQLEEKE

Amino Acids from 3' Exons

HQVFLPWQEGRNPANVQPGTRVSYVTMQNNGAVRGLKRWTKRTSSFRTSSEMPSSRSRPWGQSAQHWRGIPRYRPRLSRANRSRTCVLVSWSWKSGARRRAWCKSFRKNRWNCRKNGGDCPNRRR,IRCSSHGRREETQQTSSLGLKGSVMPKCRTKTVPEDSNVGPREPAASGPAQRCPAAGQGPGDRAHNTGGAFSQGTGPGAGPTGAEELACLCPGAGRAAEHAGGLGARASEKTGGIAGRTEGTDVPTRGEG,SGVPPMAGGKKPSKRPAWDLKGQLCDLNAELKRCRERTQTLDQENQQLQDQLRDAQQQVKALGTERTTLEGHLAKVQAQAEQGQQELKNLRACVLELEERLSTQEGLVQELQKKQVELQEERRGLMSQLEEKE