McDonnell Genome Institute

Washington University

CircRNA

chr6|31630590|31633647|+|PRRC2A|ENST00000376007.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9806

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

7

Peptide

VNSGLSSGLVPR

Amino Acids from 5' Exons

AFPESVQTVGAQAQSHLTVMHLLCYGNGALHRWIQSWPGEMSSPPHPLNPAHLPHLCARLRMRMTRG,PSSPRAFRQWGLKLRAIPSCTCYVTGTGHSTGGSKVGLGRRCLHRHTRTPPTYLTSAPGCGGQGDE,LVPRERSDSGGSSSEPFDRHAPAMLRERGTPPVDPKLAWVGDVFTATPAEPRPLTSPLRQAADEDDKGM

Amino Acids from 3' Exons

SSSRGASPGASPASPTSQQFCCLPPGPSYPQQPCWHPTGSGPAPSRECNCTRGSSKAQAWASPSPSGPLSAPNPIRAPEGQQRPQF,RPPEERPPGLPLPPPPPSSSAVFRLDQVIHSNPAGIQQALAQLSSRQGSVTAPGGHPRHKPGLPQAPQGPSPRPPTRYEPQRVNSGLSS,VLQRSVPRGFPCLPHLPAVLLSSAWTKLSTATLLASNRLWPSLVAVKGVLHQGVIQGTSLGFPKPLRAPLLGPQPDTSPRGSTAASVL