McDonnell Genome Institute

Washington University

CircRNA

chr6|31625170|31627198|+|PRRC2A|ENST00000376007.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9063

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

9

Peptide

ELGPPWGLPSGR

Amino Acids from 5' Exons

VEGHQAYCHDSLERNFRPCRRLATRTRLPRKGSLPNSRLGPDQASAPK,WKGIKPTVTILSRGISDPAGGWRPGQGCQGKGVCRTVVWARTKPPPP,GRASSLLSRFSREEFPTLQAAGDQDKAAKERESAEQSSGPGPSLRPQ

Amino Acids from 3' Exons

QGFPISFWGTAPSRWQKGQLPQQRTAHSDGLGRNLSASRDRAGTSCPKASPTPTSPGPRRELGPPWGLP,RDSQSASGEERPPEADGKKGNSPNSEPPTPKTAWAETSRPPETEPGPPAPKPPLPPPHRGPAGNWGPPGDYP,GIPNQLLVRNGPLKQMAKRATPPTANRPLLRRPGQKPLGLQRQSRDLLPQSLPYPHLTGAPPGTGAPLGTT