McDonnell Genome Institute

Washington University

CircRNA

chr6|31622689|31623909|+|PRRC2A|ENST00000376033.2

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.983

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

FGGGACR

Amino Acids from 5' Exons

GTETETLAVWPTGSGTFWGRCLQDPTYSMSFQRNVRSLGADCQGKGWKEVFLAQPVYVGQVLRDPETR,GQRLRHLLSGPQALARFGGGACRTQHTQASSAMSDRSGPTAKGKDGKKYSSLNLFDTYKGKSLEIQKPA,DRDDTCCLAHRLWHVLGEVPAGPNILNELPAQCPIARGRLPRERMERSIPRSTCLIRIRASPRSRNPL

Amino Acids from 3' Exons

LPLAMACRVSGKLPLPGVCHLQPTFQAKPRTKAMTPMSHCQKTEQDGQANRSSPTPR,CPSPWPAESRESCHCPAYATSSQPSKPESREQRQPQCLTSAKRRNRMGKQTGAVRPQE,APRHGLQSLGKVAIARRMPPPANLPSLKAENKGNDPNVSLVPKDGTGWASKQEQSDPK