McDonnell Genome Institute

Washington University

CircRNA

chr6|31616343|31616506|+|AIF1|ENST00000337917.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9621

31

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

EINWRGVQWLR

Amino Acids from 5' Exons

ISCPNECWRNLESPRLTSRNLERCPVAPGRRSATLTFSGCWARDLPSK,YHVPETNAGETWSPQDSPRAKEINWRGVQWLRGDVQLPLSQDDAGQEICHPKN,IMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILK

Amino Acids from 3' Exons

ISCPNECWRNLESPRLTSRNLERCPVAPGRRSATLTFSGCWARDLPSK,YHVPETNAGETWSPQDSPRAKEINWRGVQWLRGDVQLPLSQDDAGQEICHPKN,IMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILK