McDonnell Genome Institute

Washington University

CircRNA

chr6|30606467|30609955|-|PPP1R10|ENST00000376511.6

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9746

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

12

Peptide

STETTIMGSGPIDPK

Amino Acids from 5' Exons

RKIRRNVKMKEKVELPFLSDLQRRLRPGLRRPQRRRGRSPSLFAPQHPVMPSSVPL,EREETRRKKSNYPSATFDRGEGDPGGGPREEEGEAQVSSHHSTQSCQVPFH,KDKKKRKDEGKSRTTLPERPLTEVKAETRAEEAPEKKREKPKSLRTTAPSHAKFRST

Amino Acids from 3' Exons

KPPSWVRVPTPKNFSRAWTASLTEMGKSKVWMGFPRSS,NHHHGFGSHRPQRTSQGPGQLPPRWGSQKCGWDFQDLQ,TTIMGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIF