McDonnell Genome Institute

Washington University

CircRNA

chr6|30604007|30604511|-|PPP1R10|ENST00000376511.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9839

27

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

ESLFGAR

Amino Acids from 5' Exons

MIRSRTLVRRLSERYCQTDMHLRQRGVAMITWRRRCPGCAPGPWFCPHLLSPLEAIVRSDISRLSGRRESFRSSSTRR,KCEDQGLWGGARDTVRPTCIDSAASEPHGGEGALGVPPAPGSALTSCHPWKQSGAIYPGAGEGNPSGALPEQGE,NVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWVCPRPLVLPSPLVTPGSNSQERYIQAEREKGILQELFLNKE

Amino Acids from 3' Exons

PLWSQELWMPSQWRVLEILTNPGKAGRGKVHGLRKANENISILNWMKLNE,LFGARSSGCQASGESWRSPTDPERQEEEKCDMAGRQTERIFLFIGNT,SLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETER