McDonnell Genome Institute

Washington University

CircRNA

chr6|30489725|30489995|+|HLA-E|ENST00000376630.4

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

GAPLHLCGLR

Amino Acids from 5' Exons

APTPSISTLPCPGPAAGSPASSLWATWTTPSSCASTTTPRVRGWCRGRRGWSRRGQSIGTGRHGAPGTPHRFSEICGRCAATTIRARP,LPLLEVFPHFRVPARPRGAPLHLCGLRGRHPVRALRQRRRESEDGAAGAVDGAGGVRVLGPGDTERQGHRTDFPSESADAARLLQSERG,SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEA

Amino Acids from 3' Exons

APTPSISTLPCPGPAAGSPASSLWATWTTPSSCASTTTPRVRGWCRGRRGWSRRGQSIGTGRHGAPGTPHRFSEICGRCAATTIRARP,LPLLEVFPHFRVPARPRGAPLHLCGLRGRHPVRALRQRRRESEDGAAGAVDGAGGVRVLGPGDTERQGHRTDFPSESADAARLLQSERG,SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEA