McDonnell Genome Institute

Washington University

CircRNA

chr6|30196515|30204765|-|TRIM26|ENST00000437089.5

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9315

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

7

Peptide

AQQPAAELMQESGMERR

Amino Acids from 5' Exons

KKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQ,RSSRTRGSTLWLSLSRVISSGSGRNTCWNSWRSWSRSSRRAGRSSRAGASGSLPGWPWSSPNWRARRSSQLQSSC,EAPGPEAVHCGVAGSSVPEGAGGTPAGTAGEAGAGAHGGQGEVQEPGRRGACPAGPGHLRTGGQGAAASCRAHA

Amino Acids from 3' Exons

ESGMERRVMVLPLIVETCDHREYTDGIKGQNHSRV,SQEWREGWFYLLLWKPVEITENILTAKGRTIAGC,VRNGEKGNGFTSYCGNLLRSQRIYRHKRAEPQGA