McDonnell Genome Institute

Washington University

CircRNA

chr6|25515674|25610181|+|LRRC16A|ENST00000329474.6

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9912

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

13

Peptide

VAPSPAPGHFHRKPLQSLSLADSK

Amino Acids from 5' Exons

PLQSLSLADSKLKTEVTIIINALGSNTSLTKVDISGNGMGDMGAKMLAKALQINTKL,LCSPCPWLTRNSRLRSPSSSMPWEATPPPKWTLAATEWGTWERRCWPKHCRSTLSS,SAVLVPGLETQDGHHHHQCPGKQHLPDQSGHRQRNGGHGSEDAGQSTADQHAQ

Amino Acids from 3' Exons

MTFQTLHLARKLPFFHLSKKFLQTKREMARVAPSPAPGHFHRK,HSRLSIPESCPSSTCPEKSSFRQRERWPEPPAQPQDIFTG,DIPDSPSSPKVALLPPVLKKVPSDKERDGQSSPQPSPRTFSQE