McDonnell Genome Institute

Washington University

CircRNA

chr6|24809716|24875817|-|FAM65B|ENST00000259698.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

22

Peptide

LPEIMLVGSQSFSPGGPNGIIR

Amino Acids from 5' Exons

ATESIKMLVTLCQSDTEEIRNVASETLLSL,LLKALKCWHCVNLILKKSEMWPQKPSCLW,YKHNAGDIVSIYRNQKCGLRNPLVS

Amino Acids from 3' Exons

DYRPDSRKSCWDPSLFRLEGPMGSLEASPLRVSAASRKGDP,TTDQTPGNHVGRIPVFFAWRAQWDHKPVLCGFQRPPGKAIQ,LPTRLPEIMLVGSQSFSPGGPNGIIRSQSFAGFSGLQERRS