McDonnell Genome Institute

Washington University

CircRNA

chr6|24436575|24437289|-|GPLD1|ENST00000230036.1

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9644

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

MQIMDNSMSRR

Amino Acids from 5' Exons

MKSSWQPPGQMPLDLGEKTAEYMYIMAKRPPLVTLANANHGLHVQKK,NHHGSPPEDSRCNLWTDWGRRRPSICIWQRDHPWHDWQMQIMDNSMSRRK,EIIMAAPLRIADVTSGLIGGEDGRVYVYNGKETTLGDMTGKCKSWITPCPEEK

Amino Acids from 3' Exons

MTCLRWHSPPYTKAEPLACTHSHLTRSLCCSAPSAETAASPDLVAFCTVTWMMMA,RVGGIPDRDPTPRRSHSHVRTHIRAASAAQHLQRRPPLLPIWWRSALEPGWL,DVSKVAFLTVTLHQGGATRMYALTSDAQPLLLSTFSGDRRFSRFGGVLHLSDLDDDGL