top of page

McDonnell Genome Institute

Washington University

CircRNA

chr6|24405167|24412395|+|MRS2|ENST00000274747.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9921

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

9

Peptide

AIEALLQYWVK

Amino Acids from 5' Exons

VKCTGLEPLTSLKPLPVPQYLL,SAPVNLRLSSHFSQCSPSIYC,EVHRFRTSDVSQATLASVAPVFTV

Amino Acids from 3' Exons

YLKAVITPECLLILDYRNLNLEQWLFRELPSQLSGEGQLVTYPLPFEFRAIEALLQYW,IKLLQSVFYIIVITSNGCSGNSLHSCLERVNSLHTLYLLSLELKHSCNI,FESCDNSRVSSDIRLSFKLRAMAVPGTPFTVVWRGSTRYIPFTFVSYRSTPAIL

bottom of page