McDonnell Genome Institute

Washington University

CircRNA

chr6|20739518|20955585|+|CDKAL1|ENST00000274695.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9831

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

14

Peptide

LGMTNPPYILEHLEK

Amino Acids from 5' Exons

KSSRGEQENRTGWMRSSSPASPGLPGTEYHW,KAQEENKKIVLAGCVPQAQPRQDYLKGLSIIG,KLKRRTRKSYWLDAFLKPSLARTTLRDVSL

Amino Acids from 3' Exons

RVFVRYGPVKTRGLMAEILAPISPHSCGNWLKFLREQCGLAQIRPIFSIW,GCLDMVDQRHGGLWQRYWHQSPHTPVETGSDSGSNAEAWHDKSALYFRASG,GVCEIWLTSEDTGAYGRDIGTNLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLE