McDonnell Genome Institute

Washington University

CircRNA

chr6|18249650|18258405|-|DEK|ENST00000397239.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

49

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

ESEEEKR

Amino Acids from 5' Exons

PLPKSKKTCSKGSKKERNSSGMARKAKRTKCPEILSDESSSDEDEKKNKEESSDDEDKESEEE,HCRNLKKLVAKAVKRNGTVLEWQGRLSEPNVLKFCQMNLVVMKMKRKTRKSLQMMKIKKVKR,IAEIKNLQRQKGTEQFWNGKEGANQMSNSVRIRKEKQGRVFRRRKRG

Amino Acids from 3' Exons

KRVSSWKARGKRKKRGQCKSLPYRESHLQLHK,KESHRGRQEGKEKSREVDNASLFLTERAIYNCT,KSLIVEGKREKKKVERLTMQVSSLQREPFTIAQ