McDonnell Genome Institute

Washington University

CircRNA

chr6|18249650|18256455|-|DEK|ENST00000244776.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9008

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

ESEEEVSSLK

Amino Acids from 5' Exons

PLPKSKKTCSKGSKKERNSSGMARKAKRTKCPEILSDESSSDEDEKKNKEESSDDEDKESEEE,HCRNLKKLVAKAVKRNGTVLEWQGRLSEPNVLKFCQMNLVVMKMKRKTRKSLQMMKIKKVKR,IAEIKNLQRQKGTEQFWNGKEGANQMSNSVRIRKEKQGRVFRRRKRG

Amino Acids from 3' Exons

VSSLKKNVGQFSGFPFEKGSVQYKKKEEMLK,CPHRRMWVSSVAFHLKKEVSNIKRRKKCK,VLIKEECGSVQWLSIKRKCPIKEGRNVEK