McDonnell Genome Institute

Washington University

CircRNA

chr6|17628654|17649300|-|NUP153|ENST00000262077.2

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9675

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

9

Peptide

LVLQLEMEVPVLPK

Amino Acids from 5' Exons

ALTHLPHLRTQQPPHPSNLVSHHPLLGLLRLQALEILNLEIREDSKVCHPILGLTPVKALNFLNQEILNLEFHLNLSPKKLKKIVRMIILSLDFLLVATQFLLHFNLGYLILDRKKRKRNCPNLPLQVLALVQVLLTPPLLLLTPPLRTRAASTLEPKPRVLQWLLSHVRHQKLKKKKCLPPKEDSLLATWSLPLCHLPQCLFWEGQKRNSKSLSLLLPFLGRKLTMKSQSVNQCFPLGIQSKPKMRILQSPHLVLVQNHLRRNLNSQQKPLLPLELKLVLQL,LHIFLIFELSSLLILQIWCLIILFWAFSDFNKHWKFIWRSGRIQNRCVIRFWVYKPHERLIFTNRRFIWSFIIARRSKREFVWTFFWFKQPSFFNSISIWGISWTGRKERGTAQIFLCRFLWYRCYLHPCSCHHSDLEQEQLQPWNHRNQECFSGSFHMDIRSKRRNACHQRRILFWQRGACLSAICLSVCFGKDRRETARACHFYFPSFWEESQRAKVSTSVFLWEFRANQREFFKVHIFYDKTIEGITASKSHFCLWSSNYYS,FDTSSSSSNSAASSSFKFGVSSSSSGPSQTLTSTGNFKFGDQGGFKIGVSSDSGSINPMSEGFKFSKPIGDFKFGVSSESKPEEVKKDSKNDNFKFGLSSGLSNPVSLTPFQFGVSNLGQEEKKEELPKSSSAGFSFGTGVINSTPAPANTIVTSENKSSFNLGTIETKSASVAPFTCKTSEAKKEEMPATKGGFSFGNVEPASLPSASVFVLGRTEEKQQEPVTSTSLVFGKKADNEEPKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTA

Amino Acids from 3' Exons

EMEVPVLPKISLPITSSSLPTFNFSSPEITTSSPSPINSSQALTNK,KWKFQYYRKSLYRSPVLHCLPLILVPLRSQLPLHHPSIRLKHQT,NGSSSITENLSTDHQFFTAYLFFPDHNFLSITHQFVSSINKQ