McDonnell Genome Institute

Washington University

CircRNA

chr6|17628654|17640064|-|NUP153|ENST00000262077.2

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.992

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

13

Peptide

ATFAFGAQTSTTAAHHVTTVNSTNCKK

Amino Acids from 5' Exons

ALTHLPHLRTQQPPHPSNLVSHHPLLGLLRLQALEILNLEIREDSKVCHPILGLTPVKALNFLNQEILNLEFHLNLSPKKLKKIVRMIILSLDFLLVATQFLLHFNLGYLILDRKKRKRNCPNLPLQVLALVQVLLTPPLLLLTPPLRTRAASTLEPKPRVLQWLLSHVRHQKLKKKKCLPPKEDSLLATWSLPLCHLPQCLFWEGQKRNSKSLSLLLPFLGRKLTMKSQSVNQCFPLGIQSKPKMRILQSPHLVLVQNHLRRNLNSQQKPLLPLELKLVLQL,LHIFLIFELSSLLILQIWCLIILFWAFSDFNKHWKFIWRSGRIQNRCVIRFWVYKPHERLIFTNRRFIWSFIIARRSKREFVWTFFWFKQPSFFNSISIWGISWTGRKERGTAQIFLCRFLWYRCYLHPCSCHHSDLEQEQLQPWNHRNQECFSGSFHMDIRSKRRNACHQRRILFWQRGACLSAICLSVCFGKDRRETARACHFYFPSFWEESQRAKVSTSVFLWEFRANQREFFKVHIFYDKTIEGITASKSHFCLWSSNYYS,FDTSSSSSNSAASSSFKFGVSSSSSGPSQTLTSTGNFKFGDQGGFKIGVSSDSGSINPMSEGFKFSKPIGDFKFGVSSESKPEEVKKDSKNDNFKFGLSSGLSNPVSLTPFQFGVSNLGQEEKKEELPKSSSAGFSFGTGVINSTPAPANTIVTSENKSSFNLGTIETKSASVAPFTCKTSEAKKEEMPATKGGFSFGNVEPASLPSASVFVLGRTEEKQQEPVTSTSLVFGKKADNEEPKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTA

Amino Acids from 3' Exons

LIMSLQTVQIVRRHHLKIVRVLLDLQKSKKEVFIFKAL,SSCHYSEQYKLEDTTRLGSFTCRNPERRKCSRYSEKP,HHVTTVNSTNCKKTPPEDCEGPFRPAEILKEGSVLDILKSP