McDonnell Genome Institute

Washington University

CircRNA

chr6|17421554|17513954|+|CAP2|ENST00000229922.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9393

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

TNGQHAGTGGK

Amino Acids from 5' Exons

NGQHAGTGGKTGTSCQPPGVAVCRVPQAPWELRGSQWCHC,MANMQGLVERLERAVSRLESLSAESHRPPGNCGEVNGVIA,WPTCRDWWKDWNELSAAWSRCLQSPTGPLGTAGKSMVSLQ

Amino Acids from 3' Exons

FASCGLGEVIFEHLETSSIHQGTPHHGPHMEQN,DLRHVDWVKSYLNIWSELQAYIKEHHTTGLTWSKT,ICVMWIGSHITFGVNFKHTSRNTTPRASHGAK