McDonnell Genome Institute

Washington University

CircRNA

chr6|168650680|168653228|+|SMOC2|ENST00000354536.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9593

39

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

HSCPGAK

Amino Acids from 5' Exons

VVRVPKSMSFPAFWTRCPRTWSTPPPTPPPRQA,LSGCQKAVSDQRSGRAVHGHGPRRLRPLLLVRQ,CPGAKKHEFLTSVLDALSTDMVHAASDPSSSSG

Amino Acids from 3' Exons

ALRTRPQPYPRGAGGALVLQTTGKLQWRHRQKGNQTLQEVPSQKIKAQKMCEEVCILREQIHLRTRTDGLPGRGERGRQSGHQETP,LSEPDPSHTLEERVVHWYFKLLDKNSSGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDVNNDKSISVQELMGCLGVAKEDGKADTKKRH,SQNPTPAIPRSGWCTGTSNYWIKTPVETSAKRKSNPSRGSFAKNQSPKNVRSLLNTVTIMTNPSPYKNWAAWAWRKRTAKRTPRNAT